PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.B01338.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 295aa    MW: 31730.4 Da    PI: 7.723
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.B01338.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF58.21e-181763147
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                    k+ie +  rq  fskRr+g++KKA+ELS+LC+a va ++fs +g+ +
  Pahal.B01338.1 17 KPIEKEGARQACFSKRRQGLFKKASELSILCGAMVAAVVFSASGRSF 63
                    6899999***********************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.3E-26968IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.282969IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-241082IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-171131IPR002100Transcription factor, MADS-box
CDDcd002654.05E-301480No hitNo description
PfamPF003192.3E-221965IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-173146IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-174667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MEKGSKKSKR RKKIEIKPIE KEGARQACFS KRRQGLFKKA SELSILCGAM VAAVVFSASG  60
RSFSFGHPSF DDVVNRFLNP VATDAPAPGG ASHGNEGSVT DGVSKLNMEY LELEQSLEAE  120
KKRKERLQEA TEKEMGGRVM QWLNANIFEL GLDELLEFQT KLEEIQAIVK EKVNEVMVEG  180
RQTPRSLPQP PMEVASTSQS ANPNPMASSS APSSSIALID GFQVNDDPLL SGGVVHGVGG  240
LGNFPNKPKS CMHQRKVDLV YVCVVVPQHV ACIGNVDVSM CGVVLPAICC GLST*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012699030.11e-128PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLK4A0041e-128K4A004_SETIT; Uncharacterized protein
STRINGSi032189m1e-128(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-24AGAMOUS-like 62